PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1122951g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family NF-YA
Protein Properties Length: 434aa    MW: 47677.6 Da    PI: 10.2057
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1122951g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.73.9e-33181237158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         dep+YVNaKQy++Il+RRq Rakle+++kl +k rkpylheSRh+hA++R+RgsgGrF
  PDK_30s1122951g001 181 DEPIYVNAKQYHGILRRRQLRAKLEAQNKL-IKDRKPYLHESRHRHAMKRARGSGGRF 237
                         79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.7208.1E-455143IPR016040NAD(P)-binding domain
SMARTSM005213.1E-38179240IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115239.373180240IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-28182237IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.5E-24183205IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860185205IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.5E-24214237IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MGTIAQQSNQ MKQPVHQLPD QDSSSTQSTG QSHQELAARM EGNLHEQGAL AHSGDNVTSR  60
KQVEGHAKQV LSLGTAGVAG QPQKIDFNQS IACIPCPYAD PYFGGILAAY GSHAVHAIIS  120
TCNNERVAQV YNYWSSYWSK WVRQTKMKHL SCTNFSAEKI HPQLAGMAPS ARVPLPQPLE  180
DEPIYVNAKQ YHGILRRRQL RAKLEAQNKL IKDRKPYLHE SRHRHAMKRA RGSGGRFLNT  240
KQLQQRSQTT TTKDNKNAAS SSLLQLGGGG GGGNGTTGAA ATPTCSEVTA ASDGGLFQHQ  300
DHHLNFSTDF HPRVVGGSTQ ARFKVDNTDF TELSHQDNPK CGAATSSLMV HTDYRVSPAL  360
ISIRRKKRKE SLLEKLGVRA RKVGQILERR TWDFGSIIEK REYLLLGNWM IRDKYVGPSQ  420
LQGVGNPGEG AVAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-23181242263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1221230RHRHAMKRAR
2364369RKKRKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008791883.11e-173PREDICTED: nuclear transcription factor Y subunit A-3-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-38nuclear factor Y, subunit A3